Germany
Japan
United Kingdom
China
Goat Anti-NLGN4X (aa51-65) Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-NYGKIRGLRTPLPNE, from the internal region (near N Terminus) of the protein sequence according to NP_065793.1. |
Antibodies
View as table Download
Rabbit Polyclonal Anti-NLGN4X Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NLGN4X antibody: synthetic peptide directed towards the N terminal of human NLGN4X. Synthetic peptide located within the following region: SILASYGNVIVITINYRLGILGFLSTGDQAAKGNYGLLDQIQALRWIEEN |
Rabbit Polyclonal Anti-NLGN4X Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NLGN4X antibody: synthetic peptide directed towards the middle region of human NLGN4X. Synthetic peptide located within the following region: ELFSCNFSKNDVMLSAVVMTYWTNFAKTGDPNQPVPQDTKFIHTKPNRFE |
NLGN4X Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 697-816 of human NLGN4X (NP_065793.1). |
| Modifications | Unmodified |
Active filters
Target Symbol
- NLGN4X