Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-NLRP1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NLRP1 antibody: synthetic peptide directed towards the N terminal of human NLRP1. Synthetic peptide located within the following region: DTQEPRIVILQGAAGIGKSTLARQVKEAWGRGQLYGDRFQHVFYFSCREL |
NLRP1 Antibody - middle region
| Applications | WB |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human NLRP1 |
NLRP1 Antibody - C-terminal region
| Applications | WB |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human NLRP1 |
NLRP1 Rabbit polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 1000-1100 of human NLRP1 (NP_001028225.1). |
Active filters
Target Symbol
- NLRP1