Antibodies

Jump to Filters
View as table Download
Nucleoside Diphosphate Kinase 7 (NME7) Rabbit Polyclonal Antibody
TA349417

USD 380.00

In Stock

Rabbit Polyclonal Anti-NME7 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human NME7
Nme7 Rabbit Polyclonal Antibody
TA331277

USD 375.00

5 Days

Rabbit Polyclonal Anti-Nme7 Antibody

Applications WB
Reactivities Mouse
Immunogen The immunogen for Anti-Nme7 antibody is: synthetic peptide directed towards the N-terminal region of Mouse Nme7. Synthetic peptide located within the following region: FSRQLVLIDYGDQYTARQLGSRKEKTLALIKPDAVSKAGEIIEMINKSGF
Nucleoside Diphosphate Kinase 7 (NME7) Rabbit Polyclonal Antibody
TA379178

USD 220.00

3 Weeks

NME7 Rabbit polyclonal Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-376 of human NME7 (NP_037462.1).
Modifications Unmodified