Antibodies

Jump to Filters
View as table Download
C9orf95 (NMRK1) Rabbit Polyclonal Antibody
TA344957

USD 475.00

2 Weeks

Rabbit Polyclonal Anti-C9orf95 Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-C9orf95 antibody: synthetic peptide directed towards the N terminal of human C9orf95. Synthetic peptide located within the following region: QDDFFKPESEIETDKNGFLQYDVLEALNMEKMMSAISCWMESARHSVVST
C9orf95 (NMRK1) (N-term) Rabbit Polyclonal Antibody
AP50690PU-N

USD 450.00

2 Weeks

C9orf95 (NMRK1) (N-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 24~50 amino acids from the N-terminal region of human C9orf95