Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal anti-ITGB1BP3 antibody
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ITGB1BP3 antibody: synthetic peptide directed towards the middle region of human ITGB1BP3. Synthetic peptide located within the following region: YKPLVDLYSRRYFLTVPYEECKWRRSTRNYTVPDPPGLFDGHVWPMYQKY |
Carrier-free (BSA/glycerol-free) ITGB1BP3 mouse monoclonal antibody,clone OTI1A12
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ITGB1BP3 mouse monoclonal antibody,clone OTI3H9
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
NMRK2 rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human NMRK2 |
ITGB1BP3 mouse monoclonal antibody,clone OTI1A12
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
ITGB1BP3 mouse monoclonal antibody,clone OTI1A12, Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Biotin |
USD 420.00
4 Weeks
ITGB1BP3 mouse monoclonal antibody,clone OTI1A12, HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | HRP |
ITGB1BP3 mouse monoclonal antibody,clone OTI1A12
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
ITGB1BP3 mouse monoclonal antibody,clone OTI3H9
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
ITGB1BP3 mouse monoclonal antibody,clone OTI3H9, Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Biotin |
USD 420.00
4 Weeks
ITGB1BP3 mouse monoclonal antibody,clone OTI3H9, HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | HRP |
ITGB1BP3 mouse monoclonal antibody,clone OTI3H9
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
Active filters
Target Symbol
- NMRK2