Antibodies

Jump to Filters
View as table Download
NMT1 Rabbit Polyclonal Antibody
TA339352

USD 375.00

5 Days

Rabbit Polyclonal Anti-NMT1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-NMT1 antibody: synthetic peptide directed towards the N terminal of human NMT1. Synthetic peptide located within the following region: TMEEASKRSYQFWDTQPVPKLGEVVNTHGPVEPDKDNIRQEPYTLPQGFT
NMT1 Rabbit Polyclonal Antibody
TA351451

USD 345.00

In Stock

Rabbit Polyclonal Anti-NMT1 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human NMT1
NMT1 Rabbit Polyclonal Antibody
TA367156

USD 380.00

4 Weeks

NMT1 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human NMT1
NMT1 Rabbit Polyclonal Antibody
TA379184

USD 220.00

3 Weeks

NMT1 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-250 of human NMT1 (NP_066565.1).
Modifications Unmodified