Rabbit Polyclonal Anti-NOC4L Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NOC4L antibody: synthetic peptide directed towards the C terminal of human NOC4L. Synthetic peptide located within the following region: CRVLVHRPHGPELDADPYDPGEEDPAQSRALESSLWELQALQRHYHPEVS |
Rabbit Polyclonal Anti-NOC4L Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-NOC4L antibody is: synthetic peptide directed towards the N-terminal region of Human NOC4L. Synthetic peptide located within the following region: RSEANAVFDILAVLQSEDQEEIQEAVRTCSRLFGALLERGELFVGQLPSE |
NOC4L Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-260 of human NOC4L (NP_076983.1). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
