Rabbit Polyclonal Anti-NOMO1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NOMO1 antibody: synthetic peptide directed towards the N terminal of human NOMO1. Synthetic peptide located within the following region: DGSFRLENITTGTYTIHAQKEHLYFETVTIKIAPNTPQLADIIATGFSVC |
Rabbit Polyclonal Anti-NOMO1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NOMO1 antibody: synthetic peptide directed towards the C terminal of human NOMO1. Synthetic peptide located within the following region: QDIAQGSYIALPLTLLVLLAGYNHDKLIPLLLQLTSRLQGVRALGQAASD |
NOMO1 Antibody
| Applications | WB |
| Conjugation | Unconjugated |
NOMO1 Rabbit polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 700-1000 of human NOMO1 (NP_055102.3). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China