Rabbit anti-Nono Polyclonal Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A specific peptide of human Nono |
Rabbit anti-Nono Polyclonal Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A specific peptide of human Nono |
Rabbit Polyclonal Anti-NONO Antibody
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-NONO antibody: synthetic peptide directed towards the C terminal of human NONO. Synthetic peptide located within the following region: DGTLGLTPPTTERFGQAATMEGIGAIGGTPPAFNRAAPGAEFAPNKRRRY |
Rabbit Polyclonal Anti-NONO Antibody
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-NONO antibody: synthetic peptide directed towards the N terminal of human NONO. Synthetic peptide located within the following region: KQNHTPRKHHQHHHQQQHHQQQQQQPPPPPIPANGQQASSQNEGLTIDLK |
Goat Polyclonal Antibody against NONO / p54NRB
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-NRAAPGAEFAPNK, from the C Terminus of the protein sequence according to NP_031389.3. |
Goat Anti-NONO / p54NRB, biotinylated Antibody
Applications | WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-NRAAPGAEFAPNK., from the C Terminus of the protein sequence according to NP_031389.3. |
Carrier-free (BSA/glycerol-free) NONO mouse monoclonal antibody,clone OTI3F8
Applications | IF, IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) NONO mouse monoclonal antibody, clone OTI4D9 (formerly 4D9)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) NONO mouse monoclonal antibody, clone OTI5F1 (formerly 5F1)
Applications | IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) NONO mouse monoclonal antibody, clone OTI2E7 (formerly 2E7)
Applications | IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) NONO mouse monoclonal antibody, clone OTI2C9 (formerly 2C9)
Applications | IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) NONO mouse monoclonal antibody, clone OTI3G4 (formerly 3G4)
Applications | WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Unconjugated |
NONO Antibody - N-terminal region
Applications | WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of mouse NONO |
NONO mouse monoclonal antibody,clone OTI3F8
Applications | IF, IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Unconjugated |
NONO mouse monoclonal antibody,clone OTI3F8, Biotinylated
Applications | IF, IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Biotin |
NONO mouse monoclonal antibody,clone OTI3F8, HRP conjugated
Applications | IF, IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | HRP |
NONO mouse monoclonal antibody,clone OTI3F8
Applications | IF, IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
NONO mouse monoclonal antibody, clone OTI4D9 (formerly 4D9)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Unconjugated |
NONO mouse monoclonal antibody, clone OTI4D9 (formerly 4D9), Biotinylated
Applications | FC, IF, IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Biotin |
NONO mouse monoclonal antibody, clone OTI4D9 (formerly 4D9), HRP conjugated
Applications | FC, IF, IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | HRP |
NONO mouse monoclonal antibody, clone OTI4D9 (formerly 4D9)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
NONO mouse monoclonal antibody, clone OTI5F1 (formerly 5F1)
Applications | IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Unconjugated |
NONO mouse monoclonal antibody,clone 5F1, Biotinylated
Applications | IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Biotin |
NONO mouse monoclonal antibody,clone 5F1, HRP conjugated
Applications | IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | HRP |
NONO mouse monoclonal antibody, clone OTI5F1 (formerly 5F1)
Applications | IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
NONO mouse monoclonal antibody, clone OTI2E7 (formerly 2E7)
Applications | IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Unconjugated |
NONO mouse monoclonal antibody,clone 2E7, Biotinylated
Applications | IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Biotin |
NONO mouse monoclonal antibody,clone 2E7, HRP conjugated
Applications | IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | HRP |
NONO mouse monoclonal antibody, clone OTI2E7 (formerly 2E7)
Applications | IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
NONO mouse monoclonal antibody, clone OTI2C9 (formerly 2C9)
Applications | IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Unconjugated |
NONO mouse monoclonal antibody,clone 2C9, Biotinylated
Applications | IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Biotin |
NONO mouse monoclonal antibody,clone 2C9, HRP conjugated
Applications | IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | HRP |
NONO mouse monoclonal antibody, clone OTI2C9 (formerly 2C9)
Applications | IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
NONO mouse monoclonal antibody, clone OTI3G4 (formerly 3G4)
Applications | WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Unconjugated |
NONO mouse monoclonal antibody,clone 3G4, Biotinylated
Applications | WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Biotin |
NONO mouse monoclonal antibody,clone 3G4, HRP conjugated
Applications | WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | HRP |
NONO mouse monoclonal antibody, clone OTI3G4 (formerly 3G4)
Applications | WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".