Antibodies

Jump to Filters
View as table Download
NOP10 Rabbit Polyclonal Antibody
TA344845

USD 475.00

5 Days

Rabbit Polyclonal Anti-NOLA3 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-NOLA3 antibody: synthetic peptide directed towards the middle region of human NOLA3. Synthetic peptide located within the following region: MFLQYYLNEQGDRVYTLKKFDPMGQQTCSAHPARFSPDDKYSRHRITIKK
NOP10 Rabbit Polyclonal Antibody
TA379208

USD 220.00

3 Weeks

NOP10 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant protein of human NOP10.