Rabbit Polyclonal Anti-NOVA1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NOVA1 antibody: synthetic peptide directed towards the C terminal of human NOVA1. Synthetic peptide located within the following region: SKKGEFVPGTRNRKVTITGTPAATQAAQYLITQRITYEQGVRAANPQKVG |
Rabbit Polyclonal Anti-NOVA1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NOVA1 antibody: synthetic peptide directed towards the middle region of human NOVA1. Synthetic peptide located within the following region: TNGYFGAASPLAASAILGTEKSTDGSKDVVEIAVPENLVGAILGKGGKTL |
Goat Polyclonal Antibody against NOVA1
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-REMPQNVAKTEPVS, from the internal region of the protein sequence according to NP_002506.2 ; NP_006480.2 ; NP_006482.1. |
NOVA1 Antibody - N-terminal region
| Applications | WB |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of mouse NOVA1 |
NOVA1 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 408-507 of human NOVA1 (NP_002506.2). |
| Modifications | Unmodified |
Nogo B Receptor Rabbit monoclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Germany
Japan
United Kingdom
China
