Antibodies

Jump to Filters
View as table Download
NPAS3 Rabbit Polyclonal Antibody
TA345567

USD 475.00

5 Days

Rabbit Polyclonal Anti-NPAS3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-NPAS3 antibody is: synthetic peptide directed towards the middle region of Human NPAS3. Synthetic peptide located within the following region: CESTYQNLQALRKEKSRDAARSRRGKENFEFYELAKLLPLPAAITSQLDK
NPAS3 Rabbit Polyclonal Antibody
TA306417

USD 430.00

5 Days

Rabbit Polyclonal NPAS3 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen NPAS3 antibody was raised against a 28 amino acid peptide from near the amino terminus of human NPAS3.
NPAS3 Rabbit Polyclonal Antibody
TA306418

USD 430.00

5 Days

Rabbit Polyclonal NPAS3 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen NPAS3 antibody was raised against a 28 amino acid peptide from near the center of human NPAS3.
NPAS3 Rabbit Polyclonal Antibody
TA379246

USD 220.00

3 Weeks

NPAS3 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human NPAS3.
Modifications Unmodified