Antibodies

Jump to Filters
View as table Download
NPL4 (NPLOC4) Rabbit Polyclonal Antibody
TA343206

USD 375.00

5 Days

Rabbit Polyclonal Anti-NPLOC4 Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Nploc4 antibody is: synthetic peptide directed towards the N-terminal region of Mouse Nploc4. Synthetic peptide located within the following region: GLKAFGAPNVVEDEIDQYLSKQDGKIYRSRDPQLCRHGPLGKCVHCVPLE
NPL4 (NPLOC4) Rabbit Polyclonal Antibody
TA379258

USD 220.00

3 Weeks

NPLOC4 Rabbit polyclonal Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-270 of human NPLOC4 (NP_060391.2).
Modifications Unmodified