Rabbit Polyclonal NPTX2 Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | NPTX2 antibody was raised against a 16 amino acid synthetic peptide near the center of the human NPTX2. The immunogen is located within amino acids 170 - 220 of NPTX2. |
Rabbit Polyclonal Anti-NPTX2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NPTX2 antibody: synthetic peptide directed towards the N terminal of human NPTX2. Synthetic peptide located within the following region: VQQKETLGAQREAIRELTGKLARCEGLAGGKARGAGATGKDTMGDLPRDP |
Rabbit Polyclonal Anti-NPTX2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NPTX2 antibody: synthetic peptide directed towards the middle region of human NPTX2. Synthetic peptide located within the following region: ELEDEKSLLHNETSAHRQKTESTLNALLQRVTELERGNSAFKSPDAFKVS |
NPTX2 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human NPTX2 |
NPTX2 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 90-240 of human NPTX2 (NP_002514.1). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
