Antibodies

View as table Download

Neuropeptide Y (NPY) (68-97) rabbit polyclonal antibody, Serum

Applications IF, IHC
Reactivities Human, Rat
Immunogen Synthetic Prepro-NPY 68-97 (C-PON).

Rabbit Polyclonal Anti-NPY Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-NPY antibody is: synthetic peptide directed towards the middle region of Human NPY. Synthetic peptide located within the following region: CLGALAEAYPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRYGKRSSP

Neuropeptide Y (NPY) (31-36) rabbit polyclonal antibody, Purified

Applications ELISA, IF, IHC
Reactivities Porcine
Immunogen Synthetic Porcine Neuropeptide Y coupled to bovine thyroglobulin via glutaraldehyde

Rabbit polyclonal anti Neuropeptide Y (bo, po); neat antiserum

Applications ELISA
Reactivities Bovine, Porcine
Conjugation Unconjugated

Neuropeptide Y (NPY) rabbit polyclonal antibody, Serum

Applications IF, IHC
Reactivities Human, Rat
Immunogen Synthetic peptide corresponding to the C-flanking peptide (amino acids 68-97) of Neuropeptide Y.

Neuropeptide Y (NPY) rabbit polyclonal antibody

Applications IF, IHC
Reactivities Chicken, Feline, Guinea Pig, Human, Rat, Zebrafish
Conjugation Unconjugated

Neuropeptide Y (NPY) rabbit polyclonal antibody, Aff - Purified

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Neuropeptide Y (NPY) guinea pig polyclonal antibody

Applications IHC
Reactivities Rat
Conjugation Unconjugated

Neuropeptide Y, rabbit anti human/mouse/rat, polyclonal.

Applications ELISA
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide H-Tyr-Pro-Ser-Lys-Pro-Asp-Asn-Pro-Gly-Glu-Asp-Ala- Pro-Ala-Glu-Asp-Met-Ala-Arg-Tyr-Tyr-Ser-Ala-Leu-Arg-His-Tyr-Ile-Asn- Leu-Ile-Thr-Arg-Gln-Arg-Tyr-NH2

Neuropeptide Y (NPY), rabbit anti human/mouse/rat, polyclonal.

Applications ELISA
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide H-Tyr-Pro-Ser-Lys-Pro-Asp-Asn-Pro-Gly-Glu-Asp-Ala- Pro-Ala-Glu-Asp-Met-Ala-Arg-Tyr-Tyr-Ser-Ala-Leu-Arg-His-Tyr-Ile-Asn- Leu-Ile-Thr-Arg-Gln-Arg-Tyr-NH2 coupled to carrier protein.

Neuropeptide Y (NPY), rabbit anti human/mouse/rat/porcine, polyclonal, diluted Antiserum for RIA.

Applications ELISA
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide H-Tyr-Pro-Ser-Lys-Pro-Asp-Asn-Pro-Gly-Glu-Asp-Ala- Pro-Ala-Glu-Asp-Met-Ala-Arg-Tyr-Tyr-Ser-Ala-Leu-Arg-His-Tyr-Ile-Asn- Leu-Ile-Thr-Arg-Gln-Arg-Tyr-NH2 coupled to carrier protein.

Rabbit polyclonal anti Neuropeptide Y (bo, po); diluted antiserum

Applications ELISA
Reactivities Bovine, Porcine
Conjugation Unconjugated
Immunogen Synthetic peptide H-Tyr-Pro-Ser-Lys-Pro-Asp-Asn-Pro-Gly-Glu-Asp-Ala- Pro-Ala-Glu-Asp-Met-Ala-Arg-Tyr-Tyr-Ser-Ala-Leu-Arg-His-Tyr-Ile-Asn- Leu-Ile-Thr-Arg-Gln-Arg-Tyr-NH2 coupled to carrier protein.

Rabbit polyclonal anti Neuropeptide Y (bo, po); purified rabbit IgG

Applications ELISA
Reactivities Bovine, Porcine
Conjugation Unconjugated
Immunogen Synthetic peptide H-Tyr-Pro-Ser-Lys-Pro-Asp-Asn-Pro-Gly-Glu-Asp-Ala- Pro-Ala-Glu-Asp-Met-Ala-Arg-Tyr-Tyr-Ser-Ala-Leu-Arg-His-Tyr-Ile-Asn- Leu-Ile-Thr-Arg-Gln-Arg-Tyr-NH2 coupled to carrier protein.

Carrier-free (BSA/glycerol-free) NPY mouse monoclonal antibody, clone OTI8F8 (formerly 8F8)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Anti-NPY Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Full length fusion protein

NPY mouse monoclonal antibody, clone OTI8F8 (formerly 8F8)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated