Rabbit Polyclonal Anti-NPY1R Antibody
| Applications | IHC |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NPY1R antibody: synthetic peptide directed towards the middle region of human NPY1R. Synthetic peptide located within the following region: TDEPFQNVTLDAYKDKYVCFDQFPSDSHRLSYTTLLLVLQYFGPLCFIFI |
NPY1R rabbit polyclonal antibody, Aff - Purified
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Immunogen | Synthetic peptide, corresponding to amino acids 225-270 of Human NPY1-R. |
Rabbit Polyclonal Anti-NPY1R Antibody (Extracellular Domain)
| Applications | IHC |
| Reactivities | Human |
| Immunogen | NPY1R antibody was raised against synthetic 18 amino acid peptide from 2nd extracellular domain of human NPY1R. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset (100%); Sheep, Bovine, Dog, Elephant, Panda, Pig (94%); Hamster, Rabbit, Guinea pig (89%); Mouse, Rat, Horse (83%). |
NPY1R (C-term) rabbit polyclonal antibody, Aff - Purified
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Immunogen | Synthetic peptide mapping at the C-terminal of human NPY1R |
Rabbit polyclonal anti-NPY1R antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human NPY1R. |
Anti-NPY1R rabbit polyclonal antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 370-384 amino acids of Human neuropeptide Y receptor Y1 |
NPY1R Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human NPY1R. |
Germany
Japan
United Kingdom
China
