Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-NPY4R Antibody
| Applications | WB |
| Reactivities | Human |
| Immunogen | The immunogen for Anti-PPYR1 antibody is: synthetic peptide directed towards the N-terminal region of Human PPYR1. Synthetic peptide located within the following region: LLPKSPQGENRSKPLGTPYNFSEHCQDSVDVMVFIVTSYSIETVVGVLGN |
Rabbit Polyclonal Anti-NPY4R Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human NPY4R |
NPY4R Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the N-terminal region of Human NPY4R |
NPY4R Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-80 of human NPY4R (NP_005963.4). |
| Modifications | Unmodified |
Active filters
Target Symbol
- NPY4R