Germany
Japan
United Kingdom
China
Rabbit anti-NQO1 Polyclonal Antibody
| Applications | ELISA, ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Antibodies
View as table Download
Goat Polyclonal Antibody against NQO1
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Dog |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-SIPTDNQIKARK, from the C Terminus of the protein sequence according to NP_000894.1; NP_001020604.1; NP_001020605.1. |
Rabbit polyclonal NQO1 Antibody (Center)
| Applications | FC, IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This NQO1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 118-144 amino acids from the Central region of human NQO1. |
Rabbit Polyclonal Anti-NQO1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NQO1 antibody: synthetic peptide directed towards the C terminal of human NQO1. Synthetic peptide located within the following region: WKKRLENIWDETPLYFAPSSLFDLNFQAGFLMKKEVQDEEKNKKFGLSVG |
NQO1 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
NQO1 Rabbit polyclonal Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-274 of human NQO1 (NP_000894.1). |
| Modifications | Unmodified |
NQO1 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-274 of human NQO1 (NP_000894.1). |
NQO1 Rabbit monoclonal Antibody
| Applications | IP, WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
Active filters
Target Symbol
- NQO1