Rabbit Polyclonal Anti-NR1H2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NR1H2 antibody: synthetic peptide directed towards the N terminal of human NR1H2. Synthetic peptide located within the following region: GNGPPQPGAPSSSPTVKEEGPEPWPGGPDPDVPGTDEASSACSTDWVIPD |
LXR beta (NR1H2) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Bovine, Human, Mouse, Rat |
| Immunogen | Synthetic peptide surrounding amino acid 435 of human LXR |
LXR beta (NR1H2) (N-term) rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide selected from the N-terminal region of human NR1H2 |
Goat Polyclonal Antibody against NR1H2
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence SSPTTSSLDTPLPGC, from the N Terminus of the protein sequence according to NP_009052. |
Rabbit Polyclonal LXR-B Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | LXR-B antibody was raised against a 14 amino acid peptide from near the amino terminus human LXR-B. |
Rabbit Polyclonal Anti-Nr1h2 Antibody
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-Nr1h2 Antibody is: synthetic peptide directed towards the N-terminal region of Rat Nr1h2. Synthetic peptide located within the following region: ASGFHYNVLSCEGCKGFFRRSVVHGGAGRYACRGSGTCQMDAFMRRKCQL |
Rabbit Polyclonal Anti-NR1H2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-NR1H2 Antibody: synthetic peptide directed towards the middle region of human NR1H2. Synthetic peptide located within the following region: ETECITFLKDFTYSKDDFHRAGLQVEFINPIFEFSRAMRRLGLDDAEYAL |
Rabbit Polyclonal Anti-NR1H2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NR1H2 antibody: synthetic peptide directed towards the N terminal of human NR1H2. Synthetic peptide located within the following region: MSSPTTSSLDTPLPGNGPPQPGAPSSSPTVKEEGPEPWPGGPDPDVPGTD |
Rabbit Polyclonal Anti-NR1H2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NR1H2 antibody: synthetic peptide directed towards the middle region of human NR1H2. Synthetic peptide located within the following region: MIQQLVAAQLQCNKRSFSDQPKVTPWPLGADPQSRDARQQRFAHFTELAI |
NR1H2 rabbit polyclonal antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human NR1H2 |
NR1H2 Rabbit polyclonal Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 150-250 of human NR1H2 (NP_009052.3). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
