Rabbit polyclonal NR1H3 Antibody (Center)
| Applications | FC, IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This NR1H3 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 226-253 amino acids from the Central region of human NR1H3. |
Rabbit anti-NR1H3 Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human NR1H3 |
Goat Polyclonal Antibody against NR1H3; NR1H2
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence CRLQDKKLPPLLSEI, from the internal region of the protein sequence according to NP_005684; NP_009052. |
Rabbit Polyclonal Anti-NR1H3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NR1H3 antibody: synthetic peptide directed towards the N terminal of human NR1H3. Synthetic peptide located within the following region: MSLWLGAPVPDIPPDSAVELWKPGAQDASSQAQGGSSCILREEARMPHSA |
LXR alpha (NR1H3) (C-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Immunogen | A synthetic peptide corresponding to a sequence at the C-terminal of human LXRα, identical to the related rat and mouse sequence. |
Rabbit Polyclonal Antibody against Liver X Receptor
| Applications | WB |
| Reactivities | Human, Monkey |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to an internal portion of the human LXR protein sequence (between residues 50-150). |
Anti-NR1H3 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 50-330 amino acids of human nuclear receptor subfamily 1, group H, member 3 |
Rabbit Polyclonal Anti-NR1H3 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NR1H3 antibody: synthetic peptide directed towards the C terminal of human NR1H3. Synthetic peptide located within the following region: IHHPHDRLMFPRMLMKLVSLRTLSSVHSEQVFALRLQDKKLPPLLSEIWD |
Carrier-free (BSA/glycerol-free) NR1H3 mouse monoclonal antibody, clone OTI1A5 (formerly 1A5)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Nr1h3 Antibody - C-terminal region
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
NR1H3 rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human NR1H3 |
USD 420.00
4 Weeks
USD 420.00
4 Weeks
NR1H3 mouse monoclonal antibody, clone OTI1A5 (formerly 1A5)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
USD 420.00
4 Weeks
USD 420.00
4 Weeks
NR1H3 mouse monoclonal antibody, clone OTI1F5 (formerly 1F5)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Germany
Japan
United Kingdom
China
