Antibodies

Jump to Filters
View as table Download
NRBP2 Rabbit Polyclonal Antibody
TA344187

USD 475.00

5 Days

Rabbit Polyclonal Anti-NRBP2 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-NRBP2 antibody: synthetic peptide directed towards the middle region of human NRBP2. Synthetic peptide located within the following region: VIQMQCNLERSEDKARWHLTLLLVLEDRLHRQLTYDLLPTDSAQDLASEL