Antibodies

Jump to Filters
View as table Download
Nardilysin (NRDC) Rabbit Polyclonal Antibody
TA344218

USD 475.00

5 Days

Rabbit Polyclonal Anti-NRD1 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-NRD1 antibody: synthetic peptide directed towards the middle region of human NRD1. Synthetic peptide located within the following region: GSKMLSVHVVGYGKYELEEDGTPSSEDSNSSCEVMQLTYLPTSPLLADCI