Antibodies

Jump to Filters
View as table Download
LRRC33 (NRROS) (C-term) Rabbit Polyclonal Antibody
AP52531PU-N

USD 450.00

2 Weeks

LRRC33 (NRROS) (C-term) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 618-648 amino acids from the C-terminal region of human LRRC33
LRRC33 (NRROS) Rabbit Polyclonal Antibody
TA333349

USD 375.00

5 Days

Rabbit Polyclonal Anti-NRROS Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-NRROS Antibody: synthetic peptide directed towards the N terminal of human LRRC33. Synthetic peptide located within the following region: GLERLRELDLQRNYIFEIEGGAFDGLAELRHLNLAFNNLPCIVDFGLTRL
LRRC33 (NRROS) Rabbit Polyclonal Antibody
TA333350

USD 375.00

5 Days

Rabbit Polyclonal Anti-NRROS Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-NRROS Antibody: synthetic peptide directed towards the middle region of human LRRC33. Synthetic peptide located within the following region: LHQNCLMTLHIREHEPPGALTELDLSHNQLSELHLAPGLASCLGSLRLFN