Antibodies

Jump to Filters
View as table Download
NSDHL Rabbit Polyclonal Antibody
TA341986

USD 310.00

5 Days

Rabbit Polyclonal Anti-NSDHL Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-NSDHL antibody: synthetic peptide directed towards the middle region of human NSDHL. Synthetic peptide located within the following region: RAVLGANDPEKNFLTTAIRPHGIFGPRDPQLVPILIEAARNGKMKFVIGN
NSDHL Rabbit Polyclonal Antibody
TA379327

USD 275.00

3 Weeks

NSDHL Rabbit polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-240 of human NSDHL (NP_057006.1).