Antibodies

Jump to Filters
View as table Download
Netrin 4 (NTN4) Rabbit Polyclonal Antibody
TA338467

USD 375.00

5 Days

Rabbit Polyclonal Anti-NTN4 Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-NTN4 antibody: synthetic peptide directed towards the N terminal of human NTN4. Synthetic peptide located within the following region: EDVHREKIQLDLEAEFYFTHLIVMFKSPRPAAMVLDRSQDFGKTWKPYKY
Netrin 4 (NTN4) Rabbit Polyclonal Antibody
TA379366

USD 220.00

3 Weeks

NTN4 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 290-520 of human NTN4 (NP_067052.2).
Modifications Unmodified