Antibodies

Jump to Filters
View as table Download
Netrin G1 (NTNG1) Rabbit Polyclonal Antibody
TA342922

USD 375.00

5 Days

Rabbit Polyclonal Anti-NTNG1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-NTNG1 antibody is: synthetic peptide directed towards the C-terminal region of HUMAN NTNG1. Synthetic peptide located within the following region: YAISDIKVRGRCKCNLHATVCVYDNSKLTCECEHNTTGPDCGKCKKNYQG
Netrin G1 (NTNG1) Rabbit Polyclonal Antibody
TA379368

USD 220.00

3 Weeks

NTNG1 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 29-300 of human NTNG1 (NP_055732.2).