Antibodies

View as table Download

Rabbit Polyclonal TrkC Antibody

Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen A synthetic peptide made to the extracellular domain of the human TrkC protein (within residues 300-400). [UniProt Q16288].

Rabbit anti-NTRK3 Polyclonal Antibody

Applications ICC/IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human NTRK3

Rabbit polyclonal Anti-TrkC (extracellular)

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide (C)GHFLKEPFPESTD, corresponding to amino acid residues 393-405 of rat TrkC . Extracellular, N-terminus.

Rabbit polyclonal anti-TrkCT1 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to amino acids near the carboxyl terminus of mouse TrkCT1 protein.

Rabbit polyclonal TrkC Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen This TrkC antibody is generated from rabbits immunized with a his tag recombinant protein of human TrkC.

Rabbit Polyclonal Anti-NTRK3

Applications WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-NTRK3 antibody: synthetic peptide directed towards the C terminal of human NTRK3. Synthetic peptide located within the following region: ERPRVCPKEVYDVMLGCWQREPQQRLNIKEIYKILHALGKATPIYLDILG

Carrier-free (BSA/glycerol-free) NTRK3 mouse monoclonal antibody, clone OTI24B3 (formerly 24B3)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) NTRK3 mouse monoclonal antibody, clone OTI2B8 (formerly 2B8)

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) NTRK3 mouse monoclonal antibody, clone OTI4E10 (formerly 4E10)

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) NTRK3 mouse monoclonal antibody, clone OTI19B8 (formerly 19B8)

Applications WB
Reactivities Human, Mouse, Rat, Dog
Conjugation Unconjugated

NTRK3 Rabbit polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 40-300 of human NTRK3 (NP_001007157.1).
Modifications Unmodified

Anti-NTRK3 (TrkC) mouse monoclonal antibody, clone OTI24B3 (formerly 24B3)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Special Offer: Get a 15% discount on this product. Use code: “NEURO15".

Anti-NTRK3 (TrkC) mouse monoclonal antibody, clone OTI24B3 (formerly 24B3), Biotinylated

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Biotin

Anti-NTRK3 (TrkC) mouse monoclonal antibody, clone OTI24B3 (formerly 24B3), HRP conjugated

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation HRP

Anti-NTRK3 (TrkC) mouse monoclonal antibody, clone OTI24B3 (formerly 24B3)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Anti-NTRK3 (TrkC) mouse monoclonal antibody, clone OTI2B8 (formerly 2B8)

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Special Offer: Get a 15% discount on this product. Use code: “NEURO15".

Anti-NTRK3 (TrkC) mouse monoclonal antibody, clone OTI2B8 (formerly 2B8), Biotinylated

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Biotin

Anti-NTRK3 (TrkC) mouse monoclonal antibody, clone OTI2B8 (formerly 2B8), HRP conjugated

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation HRP

Anti-NTRK3 (TrkC) mouse monoclonal antibody, clone OTI2B8 (formerly 2B8)

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Anti-NTRK3 (TrkC) mouse monoclonal antibody, clone OTI4E10 (formerly 4E10)

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Special Offer: Get a 15% discount on this product. Use code: “NEURO15".

Anti-NTRK3 (TrkC) mouse monoclonal antibody, clone OTI4E10 (formerly 4E10), Biotinylated

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Biotin

Anti-NTRK3 (TrkC) mouse monoclonal antibody, clone OTI4E10 (formerly 4E10), HRP conjugated

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation HRP

Anti-NTRK3 (TrkC) mouse monoclonal antibody, clone OTI4E10 (formerly 4E10)

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Anti-NTRK3 (TrkC) mouse monoclonal antibody, clone OTI19B8 (formerly 19B8)

Applications WB
Reactivities Human, Mouse, Rat, Dog
Conjugation Unconjugated

Special Offer: Get a 15% discount on this product. Use code: “NEURO15".

Anti-NTRK3 (TrkC) mouse monoclonal antibody, clone OTI19B8 (formerly 19B8)

Applications WB
Reactivities Human, Mouse, Rat, Dog
Conjugation Unconjugated