Antibodies

Jump to Filters
View as table Download
NUDT22 Rabbit Polyclonal Antibody
TA373010

USD 380.00

4 Weeks

NUDT22 rabbit polyclonal antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human NUDT22
NUDT22 (C-term) Rabbit Polyclonal Antibody
AP52963PU-N

USD 450.00

2 Weeks

NUDT22 (C-term) rabbit polyclonal antibody, Aff - Purified

Applications FC, IHC, WB
Reactivities Human
Immunogen Synthetic peptide - KLH conjugated - corresponding to the C-terminal region (between 227-257aa) of human NUDT22.
NUDT22 Rabbit Polyclonal Antibody
TA342965

USD 375.00

5 Days

Rabbit Polyclonal Anti-NUDT22 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-NUDT22 antibody: synthetic peptide directed towards the C terminal of human NUDT22. Synthetic peptide located within the following region: FYVQCSLTSEQVRKHYLSGGPEAHESTGIFFVETQNVRRLPETEMWAELC
NUDT22 Rabbit Polyclonal Antibody
TA365272

USD 380.00

4 Weeks

NUDT22 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human NUDT22
NUDT22 Rabbit Polyclonal Antibody
TA369590

USD 380.00

4 Weeks

NUDT22 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human NUDT22