Germany
Japan
United Kingdom
China
Rabbit anti-NUP62 Polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human NUP62 |
Antibodies
View as table Download
Rabbit polyclonal antibody to nucleoporin p62 (nucleoporin 62kDa)
| Applications | IHC, IP, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein fragment contain a sequence corresponding to a region within amino acids 230 and 490 of Nucleoporin p62 |
Rabbit Polyclonal Anti-NUP62 Antibody
| Applications | IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NUP62 antibody: synthetic peptide directed towards the N terminal of human NUP62. Synthetic peptide located within the following region: SGFNFGGTGAPTGGFTFGTAKTATTTPATGFSFSTSGTGGFNFGAPFQPA |
NUP62 (C-term) rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide selected from the C-terminal region of human NUP62 |
Rabbit Polyclonal Anti-NUP62 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-NUP62 antibody is: synthetic peptide directed towards the middle region of Human NUP62. Synthetic peptide located within the following region: TAPPGPGAAAGAAASSAMTYAQLESLINKWSLELEDQERHFLQQATQVNA |
Rabbit Polyclonal Anti-NUP62 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human NUP62 |
NUP62 Antibody - middle region
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of mouse NUP62 |
NUP62 rabbit polyclonal antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human NUP62 |
Active filters
Target Symbol
- NUP62