Antibodies

Jump to Filters
View as table Download
NXPH4 Rabbit Polyclonal Antibody
TA315168

USD 345.00

In Stock

Rabbit polyclonal anti-NXPH4 antibody

Applications IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human NXPH4.
NXPH4 Rabbit Polyclonal Antibody
AP21080PU-N

USD 370.00

2 Weeks

NXPH4 rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Rat
NXPH4 (C-term) Rabbit Polyclonal Antibody
AP52980PU-N

USD 450.00

2 Weeks

NXPH4 (C-term) rabbit polyclonal antibody, Aff - Purified

Applications FC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 226-255 amino acids from the C-terminal region of Human Neurexophilin-4
NXPH4 Rabbit Polyclonal Antibody
TA337643

USD 375.00

5 Days

Rabbit Polyclonal Anti-NXPH4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-NXPH4 antibody: synthetic peptide directed towards the N terminal of human NXPH4. Synthetic peptide located within the following region: MRLLPEWFLLLFGPWLLRKAVSAQIPESGRPQYLGLRPAAAGAGAPGQQL