Rabbit Polyclonal NAPE-PLD Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide made to an internal portion of the mouse protein (within residues 1-100). [Swiss-Prot# Q8BH82] |
Rabbit Polyclonal NAPE-PLD Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide made to an internal portion of the mouse protein (within residues 1-100). [Swiss-Prot# Q8BH82] |
Rabbit Polyclonal Anti-NAPE-PLD Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-NAPE-PLD Antibody: synthetic peptide directed towards the N terminal of human NAPE-PLD. Synthetic peptide located within the following region: TWKNPSIPNVLRWLIMEKDHSSVPSSKEELDKELPVLKPYFITNPEEAGV |
Rabbit Polyclonal Anti-NAPEPLD Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-NAPEPLD Antibody is: synthetic peptide directed towards the C-terminal region of HUMAN NAPEPLD. Synthetic peptide located within the following region: AFEEIGKRFGPFDLAAIPIGAYEPRWFMKYQHVDPEEAVRIHTDVQTKKS |
Carrier-free (BSA/glycerol-free) NAPEPLD mouse monoclonal antibody, clone OTI4B12 (formerly 4B12)
Applications | FC, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) NAPEPLD mouse monoclonal antibody, clone OTI5F7 (formerly 5F7)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) NAPEPLD mouse monoclonal antibody, clone OTI7B9 (formerly 7B9)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) NAPEPLD mouse monoclonal antibody, clone OTI5F3 (formerly 5F3)
Applications | FC, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) NAPEPLD mouse monoclonal antibody, clone OTI1H4 (formerly 1H4)
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) NAPEPLD mouse monoclonal antibody, clone OTI3D5 (formerly 3D5)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
NAPEPLD (NAPE-PLD) mouse monoclonal antibody, clone OTI4B12 (formerly 4B12)
Applications | FC, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
NAPEPLD (NAPE-PLD) mouse monoclonal antibody, clone OTI4B12 (formerly 4B12), Biotinylated
Applications | FC, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
USD 420.00
4 Weeks
NAPEPLD (NAPE-PLD) mouse monoclonal antibody, clone OTI4B12 (formerly 4B12), HRP conjugated
Applications | FC, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
NAPEPLD (NAPE-PLD) mouse monoclonal antibody, clone OTI4B12 (formerly 4B12)
Applications | FC, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
NAPEPLD (NAPE-PLD) mouse monoclonal antibody, clone OTI5F7 (formerly 5F7)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
NAPEPLD (NAPE-PLD) mouse monoclonal antibody, clone OTI5F7 (formerly 5F7), Biotinylated
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
USD 420.00
4 Weeks
NAPEPLD (NAPE-PLD) mouse monoclonal antibody, clone OTI5F7 (formerly 5F7), HRP conjugated
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
NAPEPLD (NAPE-PLD) mouse monoclonal antibody, clone OTI5F7 (formerly 5F7)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
NAPEPLD (NAPE-PLD) mouse monoclonal antibody, clone OTI7B9 (formerly 7B9)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
5 Days
NAPEPLD mouse monoclonal antibody,clone 7B9, Biotinylated
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
USD 420.00
5 Days
NAPEPLD mouse monoclonal antibody,clone 7B9, HRP conjugated
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
NAPEPLD (NAPE-PLD) mouse monoclonal antibody, clone OTI7B9 (formerly 7B9)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
NAPEPLD (NAPE-PLD) mouse monoclonal antibody, clone OTI5F3 (formerly 5F3)
Applications | FC, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
NAPEPLD (NAPE-PLD) mouse monoclonal antibody, clone OTI5F3 (formerly 5F3), Biotinylated
Applications | FC, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
USD 420.00
4 Weeks
NAPEPLD (NAPE-PLD) mouse monoclonal antibody, clone OTI5F3 (formerly 5F3), HRP conjugated
Applications | FC, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
NAPEPLD (NAPE-PLD) mouse monoclonal antibody, clone OTI5F3 (formerly 5F3)
Applications | FC, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
NAPEPLD (NAPE-PLD) mouse monoclonal antibody, clone OTI1H4 (formerly 1H4)
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
NAPEPLD (NAPE-PLD) mouse monoclonal antibody, clone OTI1H4 (formerly 1H4), Biotinylated
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
USD 420.00
4 Weeks
NAPEPLD (NAPE-PLD) mouse monoclonal antibody, clone OTI1H4 (formerly 1H4), HRP conjugated
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
NAPEPLD (NAPE-PLD) mouse monoclonal antibody, clone OTI1H4 (formerly 1H4)
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
NAPEPLD (NAPE-PLD) mouse monoclonal antibody, clone OTI3D5 (formerly 3D5)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
NAPEPLD (NAPE-PLD) mouse monoclonal antibody, clone OTI3D5 (formerly 3D5), Biotinylated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
USD 420.00
4 Weeks
NAPEPLD (NAPE-PLD) mouse monoclonal antibody, clone OTI3D5 (formerly 3D5), HRP conjugated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
NAPEPLD (NAPE-PLD) mouse monoclonal antibody, clone OTI3D5 (formerly 3D5)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |