Rabbit polyclonal Anti-NCAPH2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NCAPH2 antibody: synthetic peptide directed towards the N terminal of human NCAPH2. Synthetic peptide located within the following region: EYLYSLVYQALDFISGKRRAKQLSSVQEDRANGVASSGVPQEAENEFLSL |
Rabbit polyclonal Anti-NCAPH2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NCAPH2 antibody: synthetic peptide directed towards the N terminal of human NCAPH2. Synthetic peptide located within the following region: SGVPQEAENEFLSLDDFPDSRTNVDLKNDQTPSEVLIIPLLPMALVAPDE |
Germany
Japan
United Kingdom
China