Antibodies

Jump to Filters
View as table Download
NCKAP1L Goat Polyclonal Antibody
AP22962PU-N

USD 440.00

2 Weeks

NCKAP1L goat polyclonal antibody, Aff - Purified

Applications IHC
Reactivities Bat, Bovine, Canine, Equine, Hamster, Human, Monkey, Mouse, Rabbit, Rat
Immunogen Synthetic peptide from human NCKAP1L
NCKAP1L Rabbit Polyclonal Antibody
TA342431

USD 375.00

5 Days

Rabbit Polyclonal Anti-NCKAP1L Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-NCKAP1L antibody: synthetic peptide directed towards the N terminal of human NCKAP1L. Synthetic peptide located within the following region: CSDPKSKPPFLLEKSMEPSLKYINKKFPNIDVRNSTQHLGPVHREKAEII
NCKAP1L Rabbit Polyclonal Antibody
TA342432

USD 375.00

5 Days

Rabbit Polyclonal Anti-NCKAP1L Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-NCKAP1L antibody: synthetic peptide directed towards the C terminal of human NCKAP1L. Synthetic peptide located within the following region: LPLLATDPSSFYSIEKDGYNNNIHCLTKAIIQVSAALFTLYNKNIETHLK