Rabbit anti-NCOA4 Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human NCOA4 |
Rabbit anti-NCOA4 Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human NCOA4 |
Rabbit Polyclonal Anti-Ncoa4 Antibody
Applications | WB |
Reactivities | Mouse |
Immunogen | The immunogen for Anti-Ncoa4 Antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: CLIHQLEYTQNKDLANQVSVCLERLGSLALKPEDSTVLLFEADTSALRQT |
Carrier-free (BSA/glycerol-free) NCOA4 mouse monoclonal antibody, clone OTI2G4 (formerly 2G4)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) NCOA4 mouse monoclonal antibody, clone OTI2F3 (formerly 2F3)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) NCOA4 mouse monoclonal antibody, clone OTI2G10 (formerly 2G10)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (glycerol/BSA-free) NCOA4 mouse monoclonal antibody, clone OTI2F5 (formerly 2F5)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) NCOA4 mouse monoclonal antibody, clone OTI2F1 (formerly 2F1)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
NCOA4 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human NCOA4 |
NCOA4 mouse monoclonal antibody, clone OTI2G4 (formerly 2G4)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
NCOA4 mouse monoclonal antibody, clone OTI2G4 (formerly 2G4), Biotinylated
Applications | WB |
Reactivities | Human |
Conjugation | Biotin |
NCOA4 mouse monoclonal antibody, clone OTI2G4 (formerly 2G4), HRP conjugated
Applications | WB |
Reactivities | Human |
Conjugation | HRP |
NCOA4 mouse monoclonal antibody, clone OTI2G4 (formerly 2G4)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
NCOA4 mouse monoclonal antibody, clone OTI2F3 (formerly 2F3)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
NCOA4 mouse monoclonal antibody, clone OTI2F3 (formerly 2F3), Biotinylated
Applications | WB |
Reactivities | Human |
Conjugation | Biotin |
NCOA4 mouse monoclonal antibody, clone OTI2F3 (formerly 2F3), HRP conjugated
Applications | WB |
Reactivities | Human |
Conjugation | HRP |
NCOA4 mouse monoclonal antibody, clone OTI2F3 (formerly 2F3)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
NCOA4 mouse monoclonal antibody, clone OTI2G10 (formerly 2G10)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
NCOA4 mouse monoclonal antibody, clone OTI2G10 (formerly 2G10), Biotinylated
Applications | WB |
Reactivities | Human |
Conjugation | Biotin |
NCOA4 mouse monoclonal antibody, clone OTI2G10 (formerly 2G10), HRP conjugated
Applications | WB |
Reactivities | Human |
Conjugation | HRP |
NCOA4 mouse monoclonal antibody, clone OTI2G10 (formerly 2G10)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
NCOA4 mouse monoclonal antibody, clone OTI2F5 (formerly 2F5)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
NCOA4 mouse monoclonal antibody, clone OTI2F5 (formerly 2F5), Biotinylated
Applications | WB |
Reactivities | Human |
Conjugation | Biotin |
NCOA4 mouse monoclonal antibody, clone OTI2F5 (formerly 2F5), HRP conjugated
Applications | WB |
Reactivities | Human |
Conjugation | HRP |
NCOA4 mouse monoclonal antibody, clone OTI2F5 (formerly 2F5)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
NCOA4 mouse monoclonal antibody, clone OTI2F1 (formerly 2F1)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
NCOA4 mouse monoclonal antibody, clone OTI2F1 (formerly 2F1), Biotinylated
Applications | WB |
Reactivities | Human |
Conjugation | Biotin |
NCOA4 mouse monoclonal antibody, clone OTI2F1 (formerly 2F1), HRP conjugated
Applications | WB |
Reactivities | Human |
Conjugation | HRP |
NCOA4 mouse monoclonal antibody, clone OTI2F1 (formerly 2F1)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".