Antibodies

View as table Download

Rabbit anti-NCOA4 Polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant protein of human NCOA4

Rabbit Polyclonal Anti-Ncoa4 Antibody

Applications WB
Reactivities Mouse
Immunogen The immunogen for Anti-Ncoa4 Antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: CLIHQLEYTQNKDLANQVSVCLERLGSLALKPEDSTVLLFEADTSALRQT

Carrier-free (BSA/glycerol-free) NCOA4 mouse monoclonal antibody, clone OTI2G4 (formerly 2G4)

Applications WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) NCOA4 mouse monoclonal antibody, clone OTI2F3 (formerly 2F3)

Applications WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) NCOA4 mouse monoclonal antibody, clone OTI2G10 (formerly 2G10)

Applications WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (glycerol/BSA-free) NCOA4 mouse monoclonal antibody, clone OTI2F5 (formerly 2F5)

Applications WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) NCOA4 mouse monoclonal antibody, clone OTI2F1 (formerly 2F1)

Applications WB
Reactivities Human
Conjugation Unconjugated

NCOA4 rabbit polyclonal antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human NCOA4

NCOA4 mouse monoclonal antibody, clone OTI2G4 (formerly 2G4)

Applications WB
Reactivities Human
Conjugation Unconjugated

NCOA4 mouse monoclonal antibody, clone OTI2G4 (formerly 2G4), Biotinylated

Applications WB
Reactivities Human
Conjugation Biotin

NCOA4 mouse monoclonal antibody, clone OTI2G4 (formerly 2G4), HRP conjugated

Applications WB
Reactivities Human
Conjugation HRP

NCOA4 mouse monoclonal antibody, clone OTI2F3 (formerly 2F3)

Applications WB
Reactivities Human
Conjugation Unconjugated

NCOA4 mouse monoclonal antibody, clone OTI2F3 (formerly 2F3), Biotinylated

Applications WB
Reactivities Human
Conjugation Biotin

NCOA4 mouse monoclonal antibody, clone OTI2F3 (formerly 2F3), HRP conjugated

Applications WB
Reactivities Human
Conjugation HRP

NCOA4 mouse monoclonal antibody, clone OTI2G10 (formerly 2G10)

Applications WB
Reactivities Human
Conjugation Unconjugated

NCOA4 mouse monoclonal antibody, clone OTI2G10 (formerly 2G10), Biotinylated

Applications WB
Reactivities Human
Conjugation Biotin

NCOA4 mouse monoclonal antibody, clone OTI2G10 (formerly 2G10), HRP conjugated

Applications WB
Reactivities Human
Conjugation HRP

NCOA4 mouse monoclonal antibody, clone OTI2F5 (formerly 2F5)

Applications WB
Reactivities Human
Conjugation Unconjugated

NCOA4 mouse monoclonal antibody, clone OTI2F5 (formerly 2F5), Biotinylated

Applications WB
Reactivities Human
Conjugation Biotin

NCOA4 mouse monoclonal antibody, clone OTI2F5 (formerly 2F5), HRP conjugated

Applications WB
Reactivities Human
Conjugation HRP

NCOA4 mouse monoclonal antibody, clone OTI2F1 (formerly 2F1)

Applications WB
Reactivities Human
Conjugation Unconjugated

NCOA4 mouse monoclonal antibody, clone OTI2F1 (formerly 2F1), Biotinylated

Applications WB
Reactivities Human
Conjugation Biotin

NCOA4 mouse monoclonal antibody, clone OTI2F1 (formerly 2F1), HRP conjugated

Applications WB
Reactivities Human
Conjugation HRP