Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-NDRG3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NDRG3 antibody is: synthetic peptide directed towards the C-terminal region of Human NDRG3. Synthetic peptide located within the following region: RLARSRTHSTSSSLGSGESPFSRSVTSNQSDGTQESCESPDVLDRHQTME |
Anti-NDRG3 Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 14-30 amino acids of Human NDRG family member 3 |
NDRG3 rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human NDRG3 |
NDRG3 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 184-363 of human NDRG3 (NP_071922.2). |
| Modifications | Unmodified |
Active filters
Target Symbol
- NDRG3