Antibodies

Jump to Filters
View as table Download
NEK7 Rabbit Polyclonal Antibody
TA371236

USD 380.00

4 Weeks

NEK7 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human NEK7
NEK7 Goat Polyclonal Antibody
TA311568

USD 375.00

In Stock

Goat Anti-NEK7 (aa 274-286) Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide with sequence CINPDPEKRPDVT, from the C Terminus of the protein sequence according to NP_598001.1.
NEK7 Rabbit Polyclonal Antibody
TA308429

USD 415.00

5 Days

Rabbit Polyclonal antibody to NEK7 (NIMA (never in mitosis gene a)-related kinase 7)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region within amino acids 238 and 302 of NEK7 (Uniprot ID#Q8TDX7)
NEK7 Rabbit Polyclonal Antibody
TA329575

USD 375.00

5 Days

Rabbit polyclonal anti-NEK7 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-NEK7 antibody: synthetic peptide directed towards the N terminal of human NEK7. Synthetic peptide located within the following region: KARADCIKEIDLLKQLNHPNVIKYYASFIEDNELNIVLELADAGDLSRMI
Nek7 Rabbit Polyclonal Antibody
TA356759

USD 360.00

5 Days

Nek7 Antibody - C-terminal region

Applications WB
Reactivities Rat
Conjugation Unconjugated
NEK7 Rabbit Polyclonal Antibody
TA366935

USD 380.00

4 Weeks

NEK7 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human NEK7