Rabbit polyclonal Neuro D (Ser274) antibody(Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Neuro D around the phosphorylation site of serine 274 (P-L-SP-P-P). |
| Modifications | Phospho-specific |
Rabbit polyclonal NeuroD1 Antibody (N-term)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This NeuroD1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 15-45 amino acids from the N-terminal region of human NeuroD1. |
Rabbit Polyclonal Anti-Neuro D Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Neuro D Antibody: A synthesized peptide derived from human Neuro D |
Rabbit polyclonal Neuro D (Ab-274) antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human Neuro D around the phosphorylation site of serine 272 (P-L-SP-P-P-). |
Rabbit polyclonal NeuroD1 Antibody (C-term)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | This NeuroD1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 318-348 amino acids from the C-terminal region of human NeuroD1. |
Rabbit Polyclonal Anti-NEUROD1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NEUROD1 antibody: synthetic peptide directed towards the N terminal of human NEUROD1. Synthetic peptide located within the following region: MTKSYSESGLMGEPQPQGPPSWTDECLSSQDEEHEADKKEDDLEAMNAEE |
Rabbit Polyclonal Anti-NEUROD1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-NEUROD1 Antibody: synthetic peptide directed towards the middle region of human NEUROD1. Synthetic peptide located within the following region: ATLAGAQSHGSIFSGTAAPRCEIPIDNIMSFDSHSHHERVMSAQLNAIFH |
NEUROD1 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-70 of human NEUROD1 (NP_002491.2). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
