Germany
Japan
United Kingdom
China
Rabbit Polyclonal Anti-NDF2 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NDF2 Antibody: A synthesized peptide derived from human NDF2 |
Antibodies
View as table Download
Rabbit polyclonal anti-NDF2 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human NDF2. |
Rabbit Polyclonal Anti-NEUROD2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NEUROD2 antibody: synthetic peptide directed towards the N terminal of human NEUROD2. Synthetic peptide located within the following region: AEVKEEGELGGEEEEEEEEEEGLDEAEGERPKKRGPKKRKMTKARLERSK |
Rabbit Polyclonal Anti-NEUROD2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NEUROD2 antibody: synthetic peptide directed towards the C terminal of human NEUROD2. Synthetic peptide located within the following region: PGSRPTGHGLVFGSSAVRGGVHSENLLSYDMHLHHDRGPMYEELNAFFHN |
Active filters
Target Symbol
- NEUROD2