Rabbit Polyclonal Anti-NFAT5 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NFAT5 antibody: synthetic peptide directed towards the middle region of human NFAT5. Synthetic peptide located within the following region: PGQPQNEGQPPVTTLLSQQMPENSPLASSINTNQNIEKIDLLVSLQNQGN |
Rabbit polyclonal NFAT5/TonEBP (Ser155) antibody(Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human NFAT5/TonEBP around the phosphorylation site of serine 155 (D-N-SP-R-M). |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-NFAT5 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NFAT5 antibody: synthetic peptide directed towards the middle region of mouse NFAT5. Synthetic peptide located within the following region: TIQTQDISQPGTFPAVSAASQLPSSDALLQQATQFQTREAQSRDTIQSDT |
Anti-NFAT5 Rabbit Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 711-724 amino acids of Human nuclear factor of activated T-cells 5, tonicity-responsive |
NFAT5 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 1300 to the C-terminus of human NFAT5 (NP_619728.2). |
| Modifications | Unmodified |
NFAT5 Rabbit polyclonal Antibody
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide from human protein at AA range: 212-284 |
Germany
Japan
United Kingdom
China
