Germany
Japan
United Kingdom
China
USD 380.00
4 Weeks
Antibodies
View as table Download
USD 375.00
5 Days
Rabbit Polyclonal Anti-NFE2L1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NFE2L1 antibody: synthetic peptide directed towards the middle region of human NFE2L1. Synthetic peptide located within the following region: FGRLRDENGRPYSPSQYALQYAGDGSVLLIPRTMADQQARRQERKPKDRR |
USD 450.00
2 Weeks
Nuclear Factor Erythroid 2 Related Factor 1 (NFE2L1) (C-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human, Mouse |
| Immunogen | Synthetic peptide - KLH conjugated - corresponding to the C-terminal region (between 712-742aa) of human NFE2L1 |
Rabbit Polyclonal anti-Nfe2l1 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-Nfe2l1 antibody is: synthetic peptide directed towards the C-terminal region of MOUSE Nfe2l1. Synthetic peptide located within the following region: EVFGRLRDEHGRPYSPSQYALQYAGDGSVLLIPRTMADQQARRQERKPKD |
USD 375.00
5 Days
Rabbit Polyclonal Anti-NFE2L1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide directed towards the middle region of human NFE2L1. Synthetic peptide located within the following region: HTYNMAPSALDSADLPPPSALKKGSKEKQADFLDKQMSRDEHRARAMKIP |
USD 360.00
5 Days
USD 220.00
3 Weeks
NFE2L1 Rabbit polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 515-772 of human NFE2L1 (NP_003195.1). |
| Modifications | Unmodified |
Active filters
Target Symbol
- NFE2L1