Germany
Japan
United Kingdom
China
Rabbit polyclonal anti-NFIL3 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human NFIL3. |
Antibodies
View as table Download
NFIL3 (N-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | Synthetic peptide - KLH conjugated - corresponding to the N-terminal region (between 45-74aa) of human NFIL3. |
Rabbit Polyclonal anti-NFIL3 antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NFIL3 antibody: synthetic peptide directed towards the middle region of human NFIL3. Synthetic peptide located within the following region: GYSHSPPLLQVNRSSSNSPRTSETDDGVVGKSSDGEDEQQVPKGPIHSPV |
Rabbit Polyclonal Anti-NFIL3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NFIL3 antibody: synthetic peptide directed towards the N terminal of human NFIL3. Synthetic peptide located within the following region: MQLRKMQTVKKEQASLDASSNVDKMMVLNSALTEVSEDSTTGEDVLLSEG |
NFIL3 Rabbit polyclonal Antibody
| Applications | IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 133-462 of human NFIL3 (NP_005375.2). |
| Modifications | Unmodified |
Active filters
Target Symbol
- NFIL3