Rabbit Polyclonal Anti-NHLH1 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NHLH1 antibody: synthetic peptide directed towards the middle region of human NHLH1. Synthetic peptide located within the following region: AKYRTAHATRERIRVEAFNLAFAELRKLLPTLPPDKKLSKIEILRLAICY |
Rabbit polyclonal anti-HEN1/2 antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human HEN1/2. |
Rabbit Polyclonal Anti-NHLH1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NHLH1 antibody: synthetic peptide directed towards the N terminal of human NHLH1. Synthetic peptide located within the following region: GGPGGGQARGPEPGEPGRKDLQHLSREERRRRRRATAKYRTAHATRERIR |
NHLH1 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-60 of human NHLH1 (NP_005589.1). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China