Antibodies

Jump to Filters
View as table Download
NHSL1 Rabbit Polyclonal Antibody
TA344865

USD 475.00

5 Days

Rabbit Polyclonal Anti-NHSL1 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MNS1 antibody: synthetic peptide directed towards the middle region of human MNS1. Synthetic peptide located within the following region: KVQENEEKRLQLQNALTQKLEEMLRQREDLEQVRQELYQEEQAEIYKSKL