Rabbit Polyclonal Anti-NLRP2 Antibody - C-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NLRP2 antibody: synthetic peptide directed towards the C terminal of human NLRP2. Synthetic peptide located within the following region: FETLTCSSGTLRTLRLKIDDFNDELNKLLEEIEEKNPQLIIDTEKHHPWA |
Rabbit Polyclonal NALP2 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | NALP2 antibody was raised against a peptide corresponding to 12 amino acids near the carboxy-terminus of human NALP2. |
Goat Anti-NLRP2 / NALP2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-TEKHHPWAERPSSHD, from the C Terminus of the protein sequence according to NP_060322.1. |
NBS1 Rabbit Polyclonal (C-Terminus) Antibody
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide from human NLRP2 / NALP2. |
NLRP2 Rabbit polyclonal Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-220 of human NLRP2 (NP_060322.1). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China