Rabbit Polyclonal Anti-NOB1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NOB1 antibody: synthetic peptide directed towards the N terminal of human NOB1. Synthetic peptide located within the following region: TEIRDKATRRRLAVLPYELRFKEPLPEYVRLVTEFSKKTGDYPSLSATDI |
Rabbit Polyclonal Anti-NOB1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NOB1 antibody: synthetic peptide directed towards the C terminal of human NOB1. Synthetic peptide located within the following region: LPTPKGGKYAINPHLTEDQRFPQLRLSQKARQKTNVFAPDYIAGVSPFVE |
Carrier-free (BSA/glycerol-free) NOB1 mouse monoclonal antibody, clone OTI1C12 (formerly 1C12)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) NOB1 mouse monoclonal antibody, clone OTI4H3 (formerly 4H3)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) NOB1 mouse monoclonal antibody, clone OTI2F5 (formerly 2F5)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
NOB1 Rabbit polyclonal Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-230 of human NOB1 (NP_054781.1). |
| Modifications | Unmodified |
NOB1 mouse monoclonal antibody, clone OTI1C12 (formerly 1C12)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
NOB1 mouse monoclonal antibody, clone OTI1C12 (formerly 1C12), Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
NOB1 mouse monoclonal antibody, clone OTI1C12 (formerly 1C12), HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
NOB1 mouse monoclonal antibody, clone OTI1C12 (formerly 1C12)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
NOB1 mouse monoclonal antibody, clone OTI4H3 (formerly 4H3)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
NOB1 mouse monoclonal antibody, clone OTI4H3 (formerly 4H3), Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
NOB1 mouse monoclonal antibody, clone OTI4H3 (formerly 4H3), HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
NOB1 mouse monoclonal antibody, clone OTI4H3 (formerly 4H3)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
NOB1 mouse monoclonal antibody, clone OTI2F5 (formerly 2F5)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
NOB1 mouse monoclonal antibody, clone OTI2F5 (formerly 2F5), Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
NOB1 mouse monoclonal antibody, clone OTI2F5 (formerly 2F5), HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
NOB1 mouse monoclonal antibody, clone OTI2F5 (formerly 2F5)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Germany
Japan
United Kingdom
China