Rabbit Polyclonal anti-NR3C2 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NR3C2 antibody: synthetic peptide directed towards the N terminal of human NR3C2. Synthetic peptide located within the following region: METKGYHSLPEGLDMERRWGQVSQAVERSSLGPTERTDENNYMEIVNVSC |
Rabbit Polyclonal Anti-NR3C2 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NR3C2 antibody: synthetic peptide directed towards the middle region of human NR3C2. Synthetic peptide located within the following region: RRKNCPACRLQKCLQAGMNLGARKSKKLGKLKGIHEEQPQQQQPPPPPPP |
Rabbit Polyclonal Anti-NR3C2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NR3C2 antibody: synthetic peptide directed towards the C terminal of human NR3C2. Synthetic peptide located within the following region: VSDLLEFCFYTFRESHALKVEFPAMLVEIISDQLPKVESGNAKPLYFHRK |
Mineralocorticoid receptor (NR3C2) Rabbit polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 800 to the C-terminus of human Mineralocorticoid receptor (NR3C2) (NP_001159576.1). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
