Rabbit polyclonal Nuclear Receptor NR4A1 (Ab-351) antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human Nuclear Receptor NR4A1 around the phosphorylation site of serine 351 (L-P-SP-K-P). |
Rabbit polyclonal Nuclear Receptor NR4A1 (Ser351)(Phospho-specific)
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Nuclear Receptor NR4A1 around the phosphorylation site of serine 351 (L-P-SP-K-P). |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-NR4A1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NR4A1 antibody: synthetic peptide directed towards the N terminal of human NR4A1. Synthetic peptide located within the following region: GTPAPSPGPRDHLASDPLTPEFIKPTMDLASPEAAPAAPTALPSFSTFMD |
Rabbit Polyclonal Anti-NR4A1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NR4A1 antibody: synthetic peptide directed towards the N terminal of human NR4A1. Synthetic peptide located within the following region: GTPAPSPGPRDHLASDPLTPEFIKPTMDLASPEAAPAAPTALPSFSTFMD |
Rabbit Polyclonal Anti-NR4A1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NR4A1 antibody: synthetic peptide directed towards the C terminal of human NR4A1. Synthetic peptide located within the following region: RGRLPSKPKQPPDASPANLLTSLVRAHLDSGPSTAKLDYSKFQELVLPHF |
Rabbit Polyclonal Anti-NR4A1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NR4A1 antibody: synthetic peptide directed towards the middle region of human NR4A1. Synthetic peptide located within the following region: FQKCLAVGMVKEVVRTDSLKGRRGRLPSKPKQPPDASPANLLTSLVRAHL |
Goat Polyclonal Antibody against NR4A1
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-GRLPSKPKQPPDAS, from the internal region of the protein sequence according to NP_002126.2; NP_775180.1. |
Rabbit Polyclonal Anti-NR4A1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NR4A1 antibody is: synthetic peptide directed towards the C-terminal region of Human NR4A1. Synthetic peptide located within the following region: DSILAFSRSLHSLLVDVPAFACLSALVLITDRHGLQEPRRVEELQNRIAS |
Rabbit Polyclonal Anti-NR4A1 Antibody (N-Terminus)
| Applications | IHC |
| Reactivities | Human |
| Immunogen | NR4A1 / NUR77 antibody was raised against synthetic 16 amino acid peptide from N-terminal to DNA binding domain of human NUR77. Percent identity with other species by BLAST analysis: Human (100%); Gorilla, Gibbon, Monkey (94%); Orangutan, Marmoset, Elephant (88%); Bovine, Panda, Horse (81%). |
Rabbit Polyclonal Anti-NR4A1 Antibody (N-Terminus)
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | NR4A1 / NUR77 antibody was raised against synthetic 15 amino acid peptide from N-terminal to DNA binding domain of human NUR77. Percent identity with other species by BLAST analysis: Human, Gorilla, Orangutan, Gibbon, Monkey, Mouse, Rat, Hamster (100%); Marmoset, Elephant, Panda, Bovine, Dog, Horse (93%); Bat, Rabbit (87%). |
Rabbit Polyclonal Anti-NR4A1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human NR4A1 |
NUR77 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-170 of human NUR77 (NP_775180.1). |
| Modifications | Unmodified |
NUR77 Rabbit polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-170 of human NUR77 (NP_775180.1). |
| Modifications | Unmodified |
NUR77 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthesized peptide derived from human NUR77 |
Germany
Japan
United Kingdom
China
