Rabbit Polyclonal Anti-NSUN3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NSUN3 antibody: synthetic peptide directed towards the middle region of human NSUN3. Synthetic peptide located within the following region: GGKSIALLQCACPGYLHCNEYDSLRLRWLRQTLESFIPQPLINVIKVSEL |
Rabbit Polyclonal Anti-NSUN3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NSUN3 antibody: synthetic peptide directed towards the C terminal of human NSUN3. Synthetic peptide located within the following region: LPLLQIELLRSAIKALRPGGILVYSTCTLSKAENQDVISEILNSHGNIMP |
NSUN3 (N-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human, Mouse |
| Immunogen | KLH conjugated synthetic peptide between 90-120 amino acids from the N-terminal region of human NSUN3. |
NSUN3 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-120 of human NSUN3 (NP_071355.1). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China