Antibodies

Jump to Filters
View as table Download
NT5C1B Rabbit Polyclonal Antibody
TA344250

USD 475.00

5 Days

Rabbit Polyclonal Anti-NT5C1B Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-NT5C1B antibody: synthetic peptide directed towards the N terminal of human NT5C1B. Synthetic peptide located within the following region: MSQTSLKQKKNEPGMRSSKESLEAEKRKESDKTGVRLSNQGSQESSLRKT
NT5C1B (NT5C1B-RDH14) (N-term) Rabbit Polyclonal Antibody
AP52947PU-N

USD 450.00

2 Weeks

NT5C1B (NT5C1B-RDH14) (N-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human, Mouse
Immunogen Synthetic peptide - KLH conjugated - corresponding to the N-terminal region (between 10-40aa) of human NT5C1B.