Antibodies

View as table Download

Rabbit Polyclonal Anti-NTSR1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-NTSR1 antibody: synthetic peptide directed towards the N terminal of human NTSR1. Synthetic peptide located within the following region: FGNASGNASERVLAAPSSELDVNTDIYSKVLVTAVYLALFVVGTVGNTVT

Rabbit Polyclonal Anti-Neurotensin Receptor 1 (extracellular)

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide EQNRSADGQHAGGLVC corresponding to amino acid residues 209-224 of human Neurotensin Receptor 1. 2nd extracellular loop.

Neurotensin Receptor 1 (NTSR1) rabbit polyclonal antibody, Purified

Applications ELISA, IHC, WB
Reactivities Human, Mouse
Immunogen NTSR1 antibody was raised against synthetic peptide

Rabbit polyclonal anti-NTR1 antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human NTR1.

Rabbit Polyclonal Anti-NTSR1 Antibody (Cytoplasmic Domain)

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen NTSR1 / NTR antibody was raised against synthetic 17 amino acid peptide from 3rd cytoplasmic domain of human NTSR1. Percent identity with other species by BLAST analysis: Human, Gorilla (100%); Monkey (94%); Marmoset, Panda, Dog, Horse (88%).

NTSR1 Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide of human NTSR1

Rabbit Polyclonal Anti-NTSR1 Antibody (N-Terminus)

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen NTSR1 / NTR antibody was raised against synthetic 18 amino acid peptide from N-terminal extracellular domain of human NTSR1. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey (100%); Elephant (94%); Marmoset (89%); Hamster (83%).

Rabbit Polyclonal Anti-NTSR1 Antibody (C-Terminus)

Applications IHC
Reactivities Human
Immunogen NTSR1 / NTR antibody was raised against synthetic 19 amino acid peptide from C-terminus of human NTSR1. Percent identity with other species by BLAST analysis: Human (100%); Gorilla, Gibbon (95%); Marmoset, Horse (84%).

Anti-NTSR1 Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 402-418 amino acids of Human neurotensin receptor 1 (high affinity)